Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CHIA protein

This Human CHIA protein spans the amino acid sequence from region 1-368aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lung-specific protein TSA1902

UniProt

Q9BZP6

Expression Region

1-368aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

67.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-296AA: 1-368AAFull Length : Full Length of Isoform 2

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNIKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAPAQPIEPITAAPSGSGNGSGSSSSGGSSGGSGFCAVRANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNWA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2- (4-Bromophenyl) -3-methylbutanenitrile
OR1056320 250 mg

2- (4-Bromophenyl) -3-methylbutanenitrile

Sign In for Pricing
View Details
Naa20-set siRNA/shRNA/RNAi Lentivector (Mouse)
31369094 4x 500 ng

Naa20-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Keratin 18 (Phospho-Ser33) Rabbit pAb
E2310077 100 µL

Keratin 18 (Phospho-Ser33) Rabbit pAb

Sign In for Pricing
View Details
Human MC4R/Melanocortin receptor 4 ELISA Kit
E1563Hu 96 Tests

Human MC4R/Melanocortin receptor 4 ELISA Kit

Sign In for Pricing
View Details
CHN2 antibody - N-terminal region
MBS3210478-01 0.1 mL

CHN2 antibody - N-terminal region

Sign In for Pricing
View Details
CHN2 antibody - N-terminal region
MBS3210478-02 5x 0.1 mL

CHN2 antibody - N-terminal region

Sign In for Pricing
View Details