Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CHIA protein

This Human CHIA protein spans the amino acid sequence from region 1-368aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lung-specific protein TSA1902

UniProt

Q9BZP6

Expression Region

1-368aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

67.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-296AA: 1-368AAFull Length : Full Length of Isoform 2

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNIKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAPAQPIEPITAAPSGSGNGSGSSSSGGSSGGSGFCAVRANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNWA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human KCTD3 Protein
E30P1035 20 µg

Recombinant Human KCTD3 Protein

Sign In for Pricing
View Details
TET1 3'UTR Luciferase Stable Cell Line
TU025423 1.0 mL

TET1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Epidermal Growth Factor (EGF) Precursor (Suberites domuncula) discontinued
E3374-05G-01 20 µL

Epidermal Growth Factor (EGF) Precursor (Suberites domuncula) discontinued

Sign In for Pricing
View Details
Epidermal Growth Factor (EGF) Precursor (Suberites domuncula) discontinued
E3374-05G-02 100 µL

Epidermal Growth Factor (EGF) Precursor (Suberites domuncula) discontinued

Sign In for Pricing
View Details
Human OX40/TNFRSF4 MAb (Clone 977960)
MAB10542-100 100 µg

Human OX40/TNFRSF4 MAb (Clone 977960)

Sign In for Pricing
View Details
CD64 (High Affinity Immunoglobulin gamma Fc Receptor I, IgG Fc Receptor I, Fc-gamma RI, FcRI, Fc-gamma RIA, FcgammaRIa, FCGR1A, FCG1, FCGR1, IGFR1) (MaxLight 405) discontinued
124668-ML405 100 µL

CD64 (High Affinity Immunoglobulin gamma Fc Receptor I, IgG Fc Receptor I, Fc-gamma RI, FcRI, Fc-gamma RIA, FcgammaRIa, FCGR1A, FCG1, FCGR1, IGFR1) (MaxLight 405) discontinued

Sign In for Pricing
View Details