Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TIMM17A protein

This Human TIMM17A protein spans the amino acid sequence from region 1-171aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Inner membrane preprotein translocase Tim17a

UniProt

Q99595

Expression Region

1-171aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-146AA: 1-171AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEEYAREPCPWRIVDDCGGAFTMGTIGGGIFQAIKGFRNSPVGVNHRLRGSLTAIKTRAPQLGGSFAVWGGLFSMIDCSMVQVRGKEDPWNSITSGALTGAILAARNGPVAMVGSAAMGGILLALIEGAGILLTRFASAQFPNGPQFAEDPSQLPSTQLPSSPFGDYRQYQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Tbc1d4 shRNA (UAS) - Lentiviral mouse Tbc1d4 shRNA (UAS) (25)
GTR15175613 1 Vial

Lentiviral mouse Tbc1d4 shRNA (UAS) - Lentiviral mouse Tbc1d4 shRNA (UAS) (25)

Sign In for Pricing
View Details
Mouse Anti-Human CD66b mAb (PE/Cy7)
orb2709943 100 Tests

Mouse Anti-Human CD66b mAb (PE/Cy7)

Sign In for Pricing
View Details
EIF5AL3 Protein Vector (Human) (pPM-C-HA)
PV075367 500 ng

EIF5AL3 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
IRS1 discontinued
510755 100 µg

IRS1 discontinued

Sign In for Pricing
View Details
PLA2G2D Human Pre-designed siRNA Set A
HY-RS10622 1 Set

PLA2G2D Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Parasites, pathogenic bacteria and insect pests for veterinary medicine, part IV, 31 prepared microscope slides
84150 28 x 11 x 4 cm

Parasites, pathogenic bacteria and insect pests for veterinary medicine, part IV, 31 prepared microscope slides

Sign In for Pricing
View Details