Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SLC25A20 protein

This Human SLC25A20 protein spans the amino acid sequence from region 1-301aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Carnitine/acylcarnitine translocase

UniProt

O43772

Expression Region

1-301aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

59.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-134AA: 1-301AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MADQPKPISPLKNLLAGGFGGVCLVFVGHPLDTVKVRLQTQPPSLPGQPPMYSGTFDCFRKTLFREGITGLYRGMAAPIIGVTPMFAVCFFGFGLGKKLQQKHPEDVLSYPQLFAAGMLSGVFTTGIMTPGERIKCLLQIQASSGESKYTGTLDCAKKLYQEFGIRGIYKGTVLTLMRDVPASGMYFMTYEWLKNIFTPEGKRVSELSAPRILVAGGIAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIRDEGVTSLYKGFNAVMIRAFPANAACFLGFEVAMKFLNWATPNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tau (Phospho Tau, Microtubule-associated Protein, MAP) (Biotin)
301486-Biotin 100 µL

Tau (Phospho Tau, Microtubule-associated Protein, MAP) (Biotin)

Sign In for Pricing
View Details
IKK-alpha/beta Antibody
MBS9601676-01 0.1 mL

IKK-alpha/beta Antibody

Sign In for Pricing
View Details
IKK-alpha/beta Antibody
MBS9601676-02 0.2 mL

IKK-alpha/beta Antibody

Sign In for Pricing
View Details
IKK-alpha/beta Antibody
MBS9601676-03 5x 0.2 mL

IKK-alpha/beta Antibody

Sign In for Pricing
View Details
Olr469 ORF Vector (Rat) (pORF)
ORF072537 1.0 µg DNA

Olr469 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
OF-Deg-Lin
BA7898-1 1 mg

OF-Deg-Lin

Sign In for Pricing
View Details