Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NUTF2 protein

This Human NUTF2 protein spans the amino acid sequence from region 1-127aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Placental protein 15

UniProt

P61970

Expression Region

1-127aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-312AA: 1-127AAFull Length of BC001889 : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

sdeA Antibody, Biotin conjugated
A49571-100UL 100 µL

sdeA Antibody, Biotin conjugated

Sign In for Pricing
View Details
Recombinant Helicobacter pylori Uncharacterized protein HP_0386 (HP_0386)
MBS1140425-01 0.02 mg (E-Coli)

Recombinant Helicobacter pylori Uncharacterized protein HP_0386 (HP_0386)

Sign In for Pricing
View Details
Recombinant Helicobacter pylori Uncharacterized protein HP_0386 (HP_0386)
MBS1140425-02 0.1 mg (E-Coli)

Recombinant Helicobacter pylori Uncharacterized protein HP_0386 (HP_0386)

Sign In for Pricing
View Details
Recombinant Helicobacter pylori Uncharacterized protein HP_0386 (HP_0386)
MBS1140425-03 0.02 mg (Yeast)

Recombinant Helicobacter pylori Uncharacterized protein HP_0386 (HP_0386)

Sign In for Pricing
View Details
Recombinant Helicobacter pylori Uncharacterized protein HP_0386 (HP_0386)
MBS1140425-04 0.1 mg (Yeast)

Recombinant Helicobacter pylori Uncharacterized protein HP_0386 (HP_0386)

Sign In for Pricing
View Details
Recombinant Helicobacter pylori Uncharacterized protein HP_0386 (HP_0386)
MBS1140425-05 0.02 mg (Baculovirus)

Recombinant Helicobacter pylori Uncharacterized protein HP_0386 (HP_0386)

Sign In for Pricing
View Details