Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NAPG protein

This Human NAPG protein spans the amino acid sequence from region 1-312aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

N-ethylmaleimide-sensitive factor attachment protein gamma

UniProt

Q99747

Expression Region

1-312aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

61.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-303AA: 1-312AAFull Length : Full Length of BC001889

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAAQKINEGLEHLAKAEKYLKTGFLKWKPDYDSAASEYGKAAVAFKNAKQFEQAKDACLREAVAHENNRALFHAAKAYEQAGMMLKEMQKLPEAVQLIEKASMMYLENGTPDTAAMALERAGKLIENVDPEKAVQLYQQTANVFENDERLRQAVELLGKASRLLVRGRRFDEAALSIQKEKNIYKEIENYPTCYKKTIAQVLVHLHRNDYVAAERCVRESYSIPGFNGSEDCAALEQLLEGYDQQDQDQVSDVCNSPLFKYMDNDYAKLGLSLVVPGGGIKKKSPATPQAKPDGVTATAADEEEDEYSGGLC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gamma-parvin Mouse Monoclonal Antibody [Clone 8C5.2]
MBS4382213-01 0.02 mg (With BSA & Azide at 0.2mg/mL)

Gamma-parvin Mouse Monoclonal Antibody [Clone 8C5.2]

Sign In for Pricing
View Details
Gamma-parvin Mouse Monoclonal Antibody [Clone 8C5.2]
MBS4382213-02 0.1 mg (With BSA & Azide at 0.2mg/mL)

Gamma-parvin Mouse Monoclonal Antibody [Clone 8C5.2]

Sign In for Pricing
View Details
Gamma-parvin Mouse Monoclonal Antibody [Clone 8C5.2]
MBS4382213-03 0.1 mg (Without BSA & Azide at 1mg/mL)

Gamma-parvin Mouse Monoclonal Antibody [Clone 8C5.2]

Sign In for Pricing
View Details
Gamma-parvin Mouse Monoclonal Antibody [Clone 8C5.2]
MBS4382213-04 5x 0.1 mg (With BSA & Azide at 0.2mg/mL)

Gamma-parvin Mouse Monoclonal Antibody [Clone 8C5.2]

Sign In for Pricing
View Details
Gamma-parvin Mouse Monoclonal Antibody [Clone 8C5.2]
MBS4382213-05 5x 0.1 mg (Without BSA & Azide at 1mg/mL)

Gamma-parvin Mouse Monoclonal Antibody [Clone 8C5.2]

Sign In for Pricing
View Details
PSMB4 Antibody
R35302-100UG 100 µg

PSMB4 Antibody

Sign In for Pricing
View Details