Human NAPG protein
This Human NAPG protein spans the amino acid sequence from region 1-312aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
N-ethylmaleimide-sensitive factor attachment protein gamma
UniProt
Q99747
Expression Region
1-312aa
Tag
N-terminal GST-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Neuroscience
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
61.7 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
N-terminal GST-tagged: N-terminal GST-tagged1-303AA: 1-312AAFull Length : Full Length of BC001889
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MAAQKINEGLEHLAKAEKYLKTGFLKWKPDYDSAASEYGKAAVAFKNAKQFEQAKDACLREAVAHENNRALFHAAKAYEQAGMMLKEMQKLPEAVQLIEKASMMYLENGTPDTAAMALERAGKLIENVDPEKAVQLYQQTANVFENDERLRQAVELLGKASRLLVRGRRFDEAALSIQKEKNIYKEIENYPTCYKKTIAQVLVHLHRNDYVAAERCVRESYSIPGFNGSEDCAALEQLLEGYDQQDQDQVSDVCNSPLFKYMDNDYAKLGLSLVVPGGGIKKKSPATPQAKPDGVTATAADEEEDEYSGGLC
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6347266-01 0.2 mL
SH3GL1, CT (SH3GL1, CNSA1, SH3D2B, Endophilin-A2, EEN fusion partner of MLL, Endophilin-2, Extra eleven-nineteen leukemia fusion gene protein, SH3 domain protein 2B, SH3 domain-containing GRB2-like protein 1) (FITC)
Sign In for Pricing
View Details MBS6347266-02 5x 0.2 mL
SH3GL1, CT (SH3GL1, CNSA1, SH3D2B, Endophilin-A2, EEN fusion partner of MLL, Endophilin-2, Extra eleven-nineteen leukemia fusion gene protein, SH3 domain protein 2B, SH3 domain-containing GRB2-like protein 1) (FITC)
Sign In for Pricing
View Details 
MBS7278961-01 48 Well
Human Spectrin alpha chain, erythrocytic 1 ELISA Kit
Sign In for Pricing
View Details