Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human C19orf48 protein

This Human C19orf48 protein spans the amino acid sequence from region 1-117aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Multidrug resistance-related protein

UniProt

Q6RUI8

Expression Region

1-117aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-277AA: 1-117AAFull Length of BC020979 : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTVLEAVLEIQAITGSRLLSMVPGPARPPGSCWDPTQCTRTWLLSHTPRRRWISGLPRASCRLGEEPPPLPYCDQAYGEELSIRHRETWAWLSRTDTAWPGAPGVKQARILGELLLV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human TrkC Fc Chimera
373-TC-050 50 µg

Recombinant Human TrkC Fc Chimera

Sign In for Pricing
View Details
Recombinant Human PES1 Protein, N-His
AP90049 50 µg

Recombinant Human PES1 Protein, N-His

Sign In for Pricing
View Details
CIC Rabbit Polyclonal Antibody (HRP)
orb2611154 100 µg

CIC Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Fmoc-Arg(Mtr)-Opfp
5-06287 5 g

Fmoc-Arg(Mtr)-Opfp

Sign In for Pricing
View Details
DHCR7 (NM_001163817) Human Tagged Lenti ORF Clone
RC228922L4 10 µg

DHCR7 (NM_001163817) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
ATXN10 Rabbit Polyclonal Antibody (APC-Cy5.5)
orb1604036 100 µL

ATXN10 Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details