Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TUSC2 protein

This Human TUSC2 protein spans the amino acid sequence from region 1-110aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fusion 1 protein

UniProt

O75896

Expression Region

1-110aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-227AA: 1-110AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GASGSKARGLWPFASAAGGGGSEAAGAEQALVRPRGRAVPPFVFTRRGSMFYDEDGDLAHEFYEETIVTKNGQKRAKLRRVHKNLIPQGIVKLDHPRIHVDFPVILYEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Bromo-2-nitropyridine
sc-260749A 5 g

3-Bromo-2-nitropyridine

Sign In for Pricing
View Details
Faim3 3'UTR Lenti-reporter-Luc Vector
19676086 1.0 µg

Faim3 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
SFTPA2 Rabbit Polyclonal Antibody
E10G08823 100 µL

SFTPA2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IGFBP1, CT (Insulin-like growth factor binding protein 1, Placental protein 12, PP12)
350675 100 µg

IGFBP1, CT (Insulin-like growth factor binding protein 1, Placental protein 12, PP12)

Sign In for Pricing
View Details
Filensin (BFSP1) Human qPCR Primer Pair (NM_001195)
HP205125 200 Reactions

Filensin (BFSP1) Human qPCR Primer Pair (NM_001195)

Sign In for Pricing
View Details
LOC389493 Lentiviral Activation Particles (h)
sc-418770-LAC 200 µL

LOC389493 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details