Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TUSC2 protein

This Human TUSC2 protein spans the amino acid sequence from region 1-110aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fusion 1 protein

UniProt

O75896

Expression Region

1-110aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-227AA: 1-110AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GASGSKARGLWPFASAAGGGGSEAAGAEQALVRPRGRAVPPFVFTRRGSMFYDEDGDLAHEFYEETIVTKNGQKRAKLRRVHKNLIPQGIVKLDHPRIHVDFPVILYEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCAF Peptide - N-terminal region
MBS3225989-01 0.1 mg

PCAF Peptide - N-terminal region

Sign In for Pricing
View Details
PCAF Peptide - N-terminal region
MBS3225989-02 5x 0.1 mg

PCAF Peptide - N-terminal region

Sign In for Pricing
View Details
Human CD94 ELISA Kit
orb1676350 96 Tests

Human CD94 ELISA Kit

Sign In for Pricing
View Details
SF3B1 (phospho-Thr313)  rabbit pAb
UB-GEN-1436 100 µL

SF3B1 (phospho-Thr313) rabbit pAb

Sign In for Pricing
View Details
HIRA-Interacting Protein 3 (HIRIP3) Antibody
abx030421-01 80 µL

HIRA-Interacting Protein 3 (HIRIP3) Antibody

Sign In for Pricing
View Details
HIRA-Interacting Protein 3 (HIRIP3) Antibody
abx030421-02 400 µL

HIRA-Interacting Protein 3 (HIRIP3) Antibody

Sign In for Pricing
View Details