Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TUSC2 protein

This Human TUSC2 protein spans the amino acid sequence from region 1-110aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fusion 1 protein

UniProt

O75896

Expression Region

1-110aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-227AA: 1-110AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GASGSKARGLWPFASAAGGGGSEAAGAEQALVRPRGRAVPPFVFTRRGSMFYDEDGDLAHEFYEETIVTKNGQKRAKLRRVHKNLIPQGIVKLDHPRIHVDFPVILYEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLRG2 CRISPR Knock Out 293T Cell Line (Human)
25885141 1x 10^6 Cells / 1.0 mL

KLRG2 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Recombinant Synechocystis sp. Photosystem I reaction center subunit VIII (psaI), partial
MBS7083229 Inquire

Recombinant Synechocystis sp. Photosystem I reaction center subunit VIII (psaI), partial

Sign In for Pricing
View Details
Anti-Mouse PMN, FITC, (Polyclonal) (rabbit IgG)
MBS524302-01 2 mg

Anti-Mouse PMN, FITC, (Polyclonal) (rabbit IgG)

Sign In for Pricing
View Details
Anti-Mouse PMN, FITC, (Polyclonal) (rabbit IgG)
MBS524302-02 5x 2 mg

Anti-Mouse PMN, FITC, (Polyclonal) (rabbit IgG)

Sign In for Pricing
View Details
Liver Arginase/ARG1 Rabbit Polyclonal Antibody (Fluoro550)
orb3081818 100 µg

Liver Arginase/ARG1 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
MMS19 siRNA (h)
sc-90393 10 µM

MMS19 siRNA (h)

Sign In for Pricing
View Details