Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TPD52L1 protein

This Human TPD52L1 protein spans the amino acid sequence from region 1-144aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tumor protein D52-like 1

UniProt

Q16890

Expression Region

1-144aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-152AA: 1-144AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEAQAQGLLETEPLQGTDEDAVASADFSSMLSEEEKEELKAELVQLEDEITTLRQVLSAKERHLVEIKQKLGMNLMNELKQNFSKSWHDMQTTTAYKKTHETLSHAGQKATAAFSNVGTAISKKFGDMSYSIRHSISMPAMRNSPTFKSFEERVETTVTSLKTKVGGTNPNGGSFEEVLSSTAHASAQSLAGGSRRTKEEELQC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

rac Talinolol-d5
TRC-T005002-1MG 1 mg

rac Talinolol-d5

Sign In for Pricing
View Details
YIF1B (NM_001145462) Human Over-expression Lysate
LY428905 100 µg

YIF1B (NM_001145462) Human Over-expression Lysate

Sign In for Pricing
View Details
Activin Receptor Type IIA (ACVR2A) Mouse Monoclonal Antibody [Clone ID: OTI1F2]
CF807404 100 µg

Activin Receptor Type IIA (ACVR2A) Mouse Monoclonal Antibody [Clone ID: OTI1F2]

Sign In for Pricing
View Details
Slc32a1 (511-525) Rabbit Polyclonal Antibody
20092 100 µL

Slc32a1 (511-525) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
96 Well Gradient Thermal Cycler BTHC-104
BTHC-104 Each

96 Well Gradient Thermal Cycler BTHC-104

Sign In for Pricing
View Details
Benzalkonium Chloride-d7
TRC-B183552-50MG 50 mg

Benzalkonium Chloride-d7

Sign In for Pricing
View Details