Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TPD52L1 protein

This Human TPD52L1 protein spans the amino acid sequence from region 1-144aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tumor protein D52-like 1

UniProt

Q16890

Expression Region

1-144aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-152AA: 1-144AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEAQAQGLLETEPLQGTDEDAVASADFSSMLSEEEKEELKAELVQLEDEITTLRQVLSAKERHLVEIKQKLGMNLMNELKQNFSKSWHDMQTTTAYKKTHETLSHAGQKATAAFSNVGTAISKKFGDMSYSIRHSISMPAMRNSPTFKSFEERVETTVTSLKTKVGGTNPNGGSFEEVLSSTAHASAQSLAGGSRRTKEEELQC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pacc1 Mouse Gene Knockout Kit (CRISPR)
KN517795 1 Kit

Pacc1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2-Beta-D-Ribofuranosyl-4-thiazolecarboxylic Acid Ethyl Ester
TRC-R415730-10MG 10 mg

2-Beta-D-Ribofuranosyl-4-thiazolecarboxylic Acid Ethyl Ester

Sign In for Pricing
View Details
PR3 (PRTN3) (NM_002777) Human Recombinant Protein
TP320949L 1 mg

PR3 (PRTN3) (NM_002777) Human Recombinant Protein

Sign In for Pricing
View Details
SNRNP25 Polyclonal Antibody
E-AB-52686-01 20 µL

SNRNP25 Polyclonal Antibody

Sign In for Pricing
View Details
SNRNP25 Polyclonal Antibody
E-AB-52686-02 60 µL

SNRNP25 Polyclonal Antibody

Sign In for Pricing
View Details
SNRNP25 Polyclonal Antibody
E-AB-52686-03 120 µL

SNRNP25 Polyclonal Antibody

Sign In for Pricing
View Details