Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GSTZ1 protein

This Human GSTZ1 protein spans the amino acid sequence from region 1-216aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GSTZ1-1 Glutathione S-transferase zeta 1 (EC, 2.5.1.18)

UniProt

O43708

Expression Region

1-216aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-299AA: 1-216AAFull Length : Full Length of BC001453

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVPTLKIDGITIHQSLAIIEYLEEMRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

EARS2, CT (Probable Glutamyl-tRNA Synthetase, Mitochondrial, Glutamate-tRNA Ligase, GluRS, KIAA1970) (Biotin) discontinued
E0254-85-Biotin 200 µL

EARS2, CT (Probable Glutamyl-tRNA Synthetase, Mitochondrial, Glutamate-tRNA Ligase, GluRS, KIAA1970) (Biotin) discontinued

Sign In for Pricing
View Details
GSK-3β (E-11) Alexa Fluor® 488
sc-377213 AF488 200 µg/mL

GSK-3β (E-11) Alexa Fluor® 488

Sign In for Pricing
View Details
HOXB3, ID (HOXB3, HOX2G, Homeobox protein Hox-B3, Homeobox protein Hox-2.7, Homeobox protein Hox-2G) (MaxLight 405)
MBS6307830-01 0.1 mL

HOXB3, ID (HOXB3, HOX2G, Homeobox protein Hox-B3, Homeobox protein Hox-2.7, Homeobox protein Hox-2G) (MaxLight 405)

Sign In for Pricing
View Details
HOXB3, ID (HOXB3, HOX2G, Homeobox protein Hox-B3, Homeobox protein Hox-2.7, Homeobox protein Hox-2G) (MaxLight 405)
MBS6307830-02 5x 0.1 mL

HOXB3, ID (HOXB3, HOX2G, Homeobox protein Hox-B3, Homeobox protein Hox-2.7, Homeobox protein Hox-2G) (MaxLight 405)

Sign In for Pricing
View Details
Anti-LRRTM1 Antibody
A08006-1 100 µL

Anti-LRRTM1 Antibody

Sign In for Pricing
View Details
Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) CDPF1 Polyclonal Antibody
MBS7196452 Inquire

Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) CDPF1 Polyclonal Antibody

Sign In for Pricing
View Details