Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GSTZ1 protein

This Human GSTZ1 protein spans the amino acid sequence from region 1-216aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GSTZ1-1 Glutathione S-transferase zeta 1 (EC, 2.5.1.18)

UniProt

O43708

Expression Region

1-216aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-299AA: 1-216AAFull Length : Full Length of BC001453

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVPTLKIDGITIHQSLAIIEYLEEMRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD83 (4B5) PE
sc-53855 PE 200 µg/mL

CD83 (4B5) PE

Sign In for Pricing
View Details
Nudt16 3'UTR GFP Stable Cell Line
TU164408 1.0 mL

Nudt16 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
P2RX1 Rabbit Polyclonal Antibody (FITC)
orb2133922 100 µL

P2RX1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Tripartite motif-containing protein 3
orb1635878-01 50 µg

Tripartite motif-containing protein 3

Sign In for Pricing
View Details
Tripartite motif-containing protein 3
orb1635878-02 100 µg

Tripartite motif-containing protein 3

Sign In for Pricing
View Details
Tripartite motif-containing protein 3
orb1635878-03 1 mg

Tripartite motif-containing protein 3

Sign In for Pricing
View Details