Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PSMB10 protein

This Human PSMB10 protein spans the amino acid sequence from region 1-273aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Low molecular mass protein 10 Macropain subunit MECl-1 Multicatalytic endopeptidase complex subunit MECl-1 Proteasome MECl-1 Proteasome subunit beta-2i

UniProt

P40306

Expression Region

1-273aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-249AA: 1-273AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLKPALEPRGGFSFENCQRNASLERVLPGLKVPHARKTGTTIAGLVFQDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADAEMTTRMVASKMELHALSTGREPRVATVTRILRQTLFRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVTAGILGDLGSGGNVDACVITKTGAKLLRTLSSPTEPVKRSGRYHFVPGTTAVLTQTVKPLTLELVEETVQAMEVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EPHB2 Antibody, HRP conjugated
CSB-PA007730LB01HU-01 50 µg

EPHB2 Antibody, HRP conjugated

Sign In for Pricing
View Details
EPHB2 Antibody, HRP conjugated
CSB-PA007730LB01HU-02 100 µg

EPHB2 Antibody, HRP conjugated

Sign In for Pricing
View Details
Mmu-miR-3071-3p miRNA Inhibitor
orb1870203-01 10 nmol

Mmu-miR-3071-3p miRNA Inhibitor

Sign In for Pricing
View Details
Mmu-miR-3071-3p miRNA Inhibitor
orb1870203-02 20 nmol

Mmu-miR-3071-3p miRNA Inhibitor

Sign In for Pricing
View Details
Patz1 ORF Vector (Mouse) (pORF)
ORF053416 1.0 µg DNA

Patz1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
FGF21 Blocking Peptide
33R-2157 0.1 mg

FGF21 Blocking Peptide

Sign In for Pricing
View Details