Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Interferon gamma protein

This Human Interferon gamma protein spans the amino acid sequence from region 1-249aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IFG Protein, IFI Protein, IFN gamma Protein, IFN, immune Protein, IFN-gamma Protein, IFNG Protein, IFNG_HUMAN Protein, Immune interferon Protein, Interferon gamma Protein

UniProt

Q06323

Expression Region

1-249aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

55.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-147AA: 1-249AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAMLRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDIPVPDPVKEKEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRGETKGMIY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFKB1 (Nuclear Factor NF-kappa-B p105 Subunit, DNA-binding Factor KBF1, EBP-1, Nuclear Factor of kappa Light Polypeptide Gene Enhancer in B Cells 1, Nuclear Factor NF-kappa-B p50 Subunit, DKFZp686C01211, MGC54151) (HRP)
130338-HRP 100 µL

NFKB1 (Nuclear Factor NF-kappa-B p105 Subunit, DNA-binding Factor KBF1, EBP-1, Nuclear Factor of kappa Light Polypeptide Gene Enhancer in B Cells 1, Nuclear Factor NF-kappa-B p50 Subunit, DKFZp686C01211, MGC54151) (HRP)

Sign In for Pricing
View Details
PIC 256-F-A2-B7527 AC Signs
808052 Card of 1 Pictogram(s)

PIC 256-F-A2-B7527 AC Signs

Sign In for Pricing
View Details
PARG Mouse Monoclonal Antibody [Clone ID: LBI6F4]
AMM18490VCF 100 µg

PARG Mouse Monoclonal Antibody [Clone ID: LBI6F4]

Sign In for Pricing
View Details
Human ZNF100 shRNA Plasmid
abx965984-01 150 µg

Human ZNF100 shRNA Plasmid

Sign In for Pricing
View Details
Human ZNF100 shRNA Plasmid
abx965984-02 300 µg

Human ZNF100 shRNA Plasmid

Sign In for Pricing
View Details
IGFBP3 antibody
70R-35863 0.1 mg

IGFBP3 antibody

Sign In for Pricing
View Details