Human UBE2D4 protein
This Human UBE2D4 protein spans the amino acid sequence from region 1-147aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
E2 ubiquitin-conjugating enzyme D4 HBUCE1 Ubiquitin carrier protein D4 Ubiquitin-protein ligase D4
UniProt
Q9Y2X8
Expression Region
1-147aa
Tag
N-terminal GST-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Epigenetics & Chromatin
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
43.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
N-terminal GST-tagged: N-terminal GST-tagged1-361AA: 1-147AAFull Length : Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MALKRIQKELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLAREWTQKYAM
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PX-P4721-01 50 µg
Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A)
Sign In for Pricing
View Details PX-P4721-02 100 µg
Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A)
Sign In for Pricing
View Details PX-P4721-03 1 mg
Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A)
Sign In for Pricing
View Details 
251803-Biotin 100 µL
SMAD4 (SMAD Family Member 4, DPC4, JIP, MADH4) (Biotin)
Sign In for Pricing
View Details orb1007252 100 µL
Phospho-APC1 (Ser355) Rabbit Polyclonal Antibody (APC)
Sign In for Pricing
View Details