Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human UBE2D4 protein

This Human UBE2D4 protein spans the amino acid sequence from region 1-147aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

E2 ubiquitin-conjugating enzyme D4 HBUCE1 Ubiquitin carrier protein D4 Ubiquitin-protein ligase D4

UniProt

Q9Y2X8

Expression Region

1-147aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-361AA: 1-147AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MALKRIQKELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLAREWTQKYAM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hamster Otoferlin (OTOF) ELISA Kit
MBS9900681-01 48 Well

Hamster Otoferlin (OTOF) ELISA Kit

Sign In for Pricing
View Details
Hamster Otoferlin (OTOF) ELISA Kit
MBS9900681-02 96 Well

Hamster Otoferlin (OTOF) ELISA Kit

Sign In for Pricing
View Details
Hamster Otoferlin (OTOF) ELISA Kit
MBS9900681-03 5x 96 Well

Hamster Otoferlin (OTOF) ELISA Kit

Sign In for Pricing
View Details
Hamster Otoferlin (OTOF) ELISA Kit
MBS9900681-04 10x 96 Well

Hamster Otoferlin (OTOF) ELISA Kit

Sign In for Pricing
View Details
RGS17 Protein (N-His, Human)
P507794 100 µg

RGS17 Protein (N-His, Human)

Sign In for Pricing
View Details
Matrix Metalloproteinase 9 (MMP-9, Gelatinase B, Collagenase 4) (BSA, Azide & Glycerol Free) discontinued
M2425-05X 100 µL

Matrix Metalloproteinase 9 (MMP-9, Gelatinase B, Collagenase 4) (BSA, Azide & Glycerol Free) discontinued

Sign In for Pricing
View Details