Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TOMM40 protein

This Human TOMM40 protein spans the amino acid sequence from region 1-361aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein Haymaker Translocase of outer membrane 40KDA subunit homolog p38.5

UniProt

O96008

Expression Region

1-361aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Disease Biomarkers

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

64.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-352AA: 1-361AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGFTLPPLGGSLGAGTSTSRSSERTPGAATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQMEGVKLTVNKGLSNHFQVNHTVALSTIGESNYHFGVTYVGTKQLSPTEAFPVLVGDMDNSGSLNAQVIHQLGPGLRSKMAIQTQQSKFVNWQVDGEYRGSDFTAAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRRPGEEGTVMSLAGKYTLNNWLATVTLGQAGMHATYYHKASDQLQVGVEFEASTRMQDTSVSFGYQLDLPKANLLFKGSVDSNWIVGATLEKKLPPLPLTLALGAFLNHRKNKFQCGFGLTIG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLPI
CSB-CL021781HU 10 μg Plasmid + 200 μL Glycerol

SLPI

Sign In for Pricing
View Details
Recombinant Shigella boydii serotype 4 Peptidase T (pepT)
MBS1461587-01 0.02 mg (E-Coli)

Recombinant Shigella boydii serotype 4 Peptidase T (pepT)

Sign In for Pricing
View Details
Recombinant Shigella boydii serotype 4 Peptidase T (pepT)
MBS1461587-02 0.02 mg (Yeast)

Recombinant Shigella boydii serotype 4 Peptidase T (pepT)

Sign In for Pricing
View Details
Recombinant Shigella boydii serotype 4 Peptidase T (pepT)
MBS1461587-03 0.1 mg (E-Coli)

Recombinant Shigella boydii serotype 4 Peptidase T (pepT)

Sign In for Pricing
View Details
Recombinant Shigella boydii serotype 4 Peptidase T (pepT)
MBS1461587-04 0.1 mg (Yeast)

Recombinant Shigella boydii serotype 4 Peptidase T (pepT)

Sign In for Pricing
View Details
Recombinant Shigella boydii serotype 4 Peptidase T (pepT)
MBS1461587-05 0.02 mg (Baculovirus)

Recombinant Shigella boydii serotype 4 Peptidase T (pepT)

Sign In for Pricing
View Details