Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SLC25A15 protein

This Human SLC25A15 protein spans the amino acid sequence from region 1-301aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Solute carrier family 25 member 15

UniProt

Q9Y619

Expression Region

1-301aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

59.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-234AA: 1-301AAFull Length of BC015614 : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKSNPAIQAAIDLTAGAAGGTACVLTGQPFDTMKVKMQTFPDLYRGLTDCCLKTYSQVGFRGFYKGTSPALIANIAENSVLFMCYGFCQQVVRKVAGLDKQAKLSDLQNAAAGSFASAFAALVLCPTELVKCRLQTMYEMETSGKIAKSQNTVWSVIKSILRKDGPLGFYHGLSSTLLREVPGYFFFFGGYELSRSFFASGRSKDELGPVPLMLSGGVGGICLWLAVYPVDCIKSRIQVLSMSGKQAGFIRTFINVVKNEGITALYSGLKPTMIRAFPANGALFLAYEYSRKLMMNQLEAY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RIM2 Antibody
MBS153327-01 0.1 mg

RIM2 Antibody

Sign In for Pricing
View Details
RIM2 Antibody
MBS153327-02 5x 0.1 mg

RIM2 Antibody

Sign In for Pricing
View Details
LMNTD1 Rabbit Polyclonal Antibody (FITC)
orb2581925 100 µg

LMNTD1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Human Galectin-8 Affinity Purified Polyclonal Ab
AF1305 100 µg

Human Galectin-8 Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Signal Transducer And Activator Of Transcription 6 (STAT6)
MBS2058465-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Signal Transducer And Activator Of Transcription 6 (STAT6)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Signal Transducer And Activator Of Transcription 6 (STAT6)
MBS2058465-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Signal Transducer And Activator Of Transcription 6 (STAT6)

Sign In for Pricing
View Details