Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SLC25A15 protein

This Human SLC25A15 protein spans the amino acid sequence from region 1-301aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Solute carrier family 25 member 15

UniProt

Q9Y619

Expression Region

1-301aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

59.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-234AA: 1-301AAFull Length of BC015614 : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKSNPAIQAAIDLTAGAAGGTACVLTGQPFDTMKVKMQTFPDLYRGLTDCCLKTYSQVGFRGFYKGTSPALIANIAENSVLFMCYGFCQQVVRKVAGLDKQAKLSDLQNAAAGSFASAFAALVLCPTELVKCRLQTMYEMETSGKIAKSQNTVWSVIKSILRKDGPLGFYHGLSSTLLREVPGYFFFFGGYELSRSFFASGRSKDELGPVPLMLSGGVGGICLWLAVYPVDCIKSRIQVLSMSGKQAGFIRTFINVVKNEGITALYSGLKPTMIRAFPANGALFLAYEYSRKLMMNQLEAY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Magic™ Membrane Protein Human CHID1 (Chitinase domain containing 1) for Antibody Discovery
MP1388J Each

Magic™ Membrane Protein Human CHID1 (Chitinase domain containing 1) for Antibody Discovery

Sign In for Pricing
View Details
STC1 protein
MBS5304650-01 0.5 mg

STC1 protein

Sign In for Pricing
View Details
STC1 protein
MBS5304650-02 5x 0.5 mg

STC1 protein

Sign In for Pricing
View Details
CD31 polyclonal antibody
E43CP0199P 100 µg

CD31 polyclonal antibody

Sign In for Pricing
View Details
RlmM Antibody
orb827899 2 mg

RlmM Antibody

Sign In for Pricing
View Details
SWAP70 Rabbit Polyclonal Antibody (Fluoro550)
orb3100995 100 µg

SWAP70 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details