What is the catalog number for Human SLC25A15 protein?

The catalog number for Human SLC25A15 protein is orb54363.

What sizes are available for Human SLC25A15 protein?

Human SLC25A15 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Human SLC25A15 protein come in?

Human SLC25A15 protein is available in 3 different pack sizes.

Is Human SLC25A15 protein in stock?

Human SLC25A15 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human SLC25A15 protein

This Human SLC25A15 protein spans the amino acid sequence from region 1-301aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Solute carrier family 25 member 15

UniProt

Q9Y619

Expression Region

1-301aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

59.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-234AA: 1-301AAFull Length of BC015614 : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKSNPAIQAAIDLTAGAAGGTACVLTGQPFDTMKVKMQTFPDLYRGLTDCCLKTYSQVGFRGFYKGTSPALIANIAENSVLFMCYGFCQQVVRKVAGLDKQAKLSDLQNAAAGSFASAFAALVLCPTELVKCRLQTMYEMETSGKIAKSQNTVWSVIKSILRKDGPLGFYHGLSSTLLREVPGYFFFFGGYELSRSFFASGRSKDELGPVPLMLSGGVGGICLWLAVYPVDCIKSRIQVLSMSGKQAGFIRTFINVVKNEGITALYSGLKPTMIRAFPANGALFLAYEYSRKLMMNQLEAY