Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RGS20 protein

This Human RGS20 protein spans the amino acid sequence from region 1-234aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Gz-selective GTPase-activating protein

UniProt

O76081

Expression Region

1-234aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

53.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-299AA: 1-234AAFull Length : Full Length of BC015614

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EPAGASSPAGRVDGGLQMGSERMEMRKRQMPAAQDTPGAAPGQPGAGSRGSNACCFCWCCCCSCSCLTVRNQEDQRPTIASHELRADLPTWEESPAPTLEEVNAWAQSFDKLMVTPAGRNAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILSPKEVSLDSRVREVINRNMVEPSQHIFDDAQLQIYTLMHRDSYPRFMNSAVYKDLLQSLSEKSIEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ivacaftor hydrate 50mg
A15133-50 50 mg

Ivacaftor hydrate 50mg

Sign In for Pricing
View Details
Anti-Phospho-Actin-α/γ (Tyr55/53) Polyclonal Antibody
TMAC-00079-01 50 μL

Anti-Phospho-Actin-α/γ (Tyr55/53) Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Phospho-Actin-α/γ (Tyr55/53) Polyclonal Antibody
TMAC-00079-02 100 µL

Anti-Phospho-Actin-α/γ (Tyr55/53) Polyclonal Antibody

Sign In for Pricing
View Details
CUL4A Protein Vector (Human) (pPM-C-His)
PV011188 500 ng

CUL4A Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
C14orf115 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV813758 1.0 µg DNA

C14orf115 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
PKC alpha Blocking Peptide
MBS9618748-01 1 mg

PKC alpha Blocking Peptide

Sign In for Pricing
View Details