Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RGS20 protein

This Human RGS20 protein spans the amino acid sequence from region 1-234aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Gz-selective GTPase-activating protein

UniProt

O76081

Expression Region

1-234aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

53.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-299AA: 1-234AAFull Length : Full Length of BC015614

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EPAGASSPAGRVDGGLQMGSERMEMRKRQMPAAQDTPGAAPGQPGAGSRGSNACCFCWCCCCSCSCLTVRNQEDQRPTIASHELRADLPTWEESPAPTLEEVNAWAQSFDKLMVTPAGRNAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILSPKEVSLDSRVREVINRNMVEPSQHIFDDAQLQIYTLMHRDSYPRFMNSAVYKDLLQSLSEKSIEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFIX (Nuclear Factor 1 X-type, NF1-X, Nuclear Factor 1/X, CCAAT-box-binding Transcription Factor, CTF, Nuclear Factor I/X, NF-I/X, NFI-X, TGGCA-binding Protein) (MaxLight 490)
MBS6202101-01 0.1 mL

NFIX (Nuclear Factor 1 X-type, NF1-X, Nuclear Factor 1/X, CCAAT-box-binding Transcription Factor, CTF, Nuclear Factor I/X, NF-I/X, NFI-X, TGGCA-binding Protein) (MaxLight 490)

Sign In for Pricing
View Details
NFIX (Nuclear Factor 1 X-type, NF1-X, Nuclear Factor 1/X, CCAAT-box-binding Transcription Factor, CTF, Nuclear Factor I/X, NF-I/X, NFI-X, TGGCA-binding Protein) (MaxLight 490)
MBS6202101-02 5x 0.1 mL

NFIX (Nuclear Factor 1 X-type, NF1-X, Nuclear Factor 1/X, CCAAT-box-binding Transcription Factor, CTF, Nuclear Factor I/X, NF-I/X, NFI-X, TGGCA-binding Protein) (MaxLight 490)

Sign In for Pricing
View Details
Ruthenium red
FR01772-01 1 g

Ruthenium red

Sign In for Pricing
View Details
Ruthenium red
FR01772-02 2 g

Ruthenium red

Sign In for Pricing
View Details
Ruthenium red
FR01772-03 5 g

Ruthenium red

Sign In for Pricing
View Details
Ruthenium red
FR01772-04 10 g

Ruthenium red

Sign In for Pricing
View Details