Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PHB2 protein

This Human PHB2 protein spans the amino acid sequence from region 1-299aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

B-cell receptor-associated protein BAP37 D-prohibitin Repressor of estrogen receptor activity

UniProt

Q99623

Expression Region

1-299aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

60.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-218AA: 1-299AAFull Length of Isoform Non-brain: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAQNLKDLAGRLPAGPRGMGTALKLLLGAGAVAYGVRESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EphA1 Protein Vector (Rat) (pPM-C-HA)
19353026 500 ng

EphA1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
TXNDC3 CRISPR All-in-one AAV vector set (with saCas9)(Human)
48874151 3x 1.0 µg DNA

TXNDC3 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Human TAPP1 MAb (Clone 376409)
MAB4039-SP 25 µg

Human TAPP1 MAb (Clone 376409)

Sign In for Pricing
View Details
Rabbit Anti Chicken IgY (H&L)-AbFluor 647
MBS9526862-01 0.1 mL

Rabbit Anti Chicken IgY (H&L)-AbFluor 647

Sign In for Pricing
View Details
Rabbit Anti Chicken IgY (H&L)-AbFluor 647
MBS9526862-02 1 mL

Rabbit Anti Chicken IgY (H&L)-AbFluor 647

Sign In for Pricing
View Details
Rabbit Anti Chicken IgY (H&L)-AbFluor 647
MBS9526862-03 5x 1 mL

Rabbit Anti Chicken IgY (H&L)-AbFluor 647

Sign In for Pricing
View Details