Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CCND3 protein

This Human CCND3 protein spans the amino acid sequence from region 1-292aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CCND 3, Ccnd3, CCND3_HUMAN, CyclinD3, D3 type cyclin, G1 S specific cyclin D3, G1/S specific cyclin D3, G1/S-specific cyclin-D3

UniProt

P30281

Expression Region

1-292aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

59.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-248AA: 1-292AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKMLAYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLTIEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCLRACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NRP2 (NM_201264) Human Tagged ORF Clone
RC214608 10 µg

NRP2 (NM_201264) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Yersinia Enterocolitica coaD Protein (aa 1-159) (strain 8081)
VAng-Wyb1420-1mgEcoli 1 mg (E. coli)

Recombinant Yersinia Enterocolitica coaD Protein (aa 1-159) (strain 8081)

Sign In for Pricing
View Details
CD75 Polyclonal Antibody, Cy7 Conjugated
bs-3793R-Cy7-01 20 µL

CD75 Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
CD75 Polyclonal Antibody, Cy7 Conjugated
bs-3793R-Cy7-02 100 µL

CD75 Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
INPP1 (Inositol Polyphosphate-1-Phosphatase, MGC110984) (MaxLight 550)
247663-ML550 100 µL

INPP1 (Inositol Polyphosphate-1-Phosphatase, MGC110984) (MaxLight 550)

Sign In for Pricing
View Details
Anti-COX2/Cyclooxygenase 2/PTGS2 Antibody Picoband® (iFluor647 Conjugate)
A00084-iFluor647 100 µg

Anti-COX2/Cyclooxygenase 2/PTGS2 Antibody Picoband® (iFluor647 Conjugate)

Sign In for Pricing
View Details