Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human C14orf166 protein

This Human C14orf166 protein spans the amino acid sequence from region 1-244aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CLE7 homolog

UniProt

Q9Y224

Expression Region

1-244aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

55.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-225AA: 1-244AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MFRRKLTALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCPFKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNSKTADNATKNAEPLINLDVNNPDFKAGVMALANLLQIQRHDDYLVMLKAIRILVQERLTQDAVAKANQTKEGLPVALDKHILGFDTGDAVLNEAAQILRLLHIEELRELQTKINEAIVAVQAIIADPKTDHRLGKVGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ankyrin G Rabbit Polyclonal Antibody (BF750)
orb1602841 100 µL

Ankyrin G Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
CRLF2 (Verekitug) Recombinant Monoclonal Antibody
CSB-RA005983MA1HU-01 50 μL

CRLF2 (Verekitug) Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
CRLF2 (Verekitug) Recombinant Monoclonal Antibody
CSB-RA005983MA1HU-02 100 µL

CRLF2 (Verekitug) Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
Myelin Basic Protein Antibody [E7M20]
C21311-20uL 20 µL

Myelin Basic Protein Antibody [E7M20]

Sign In for Pricing
View Details
Recombinant Human MRPL3 Protein, N-His
orb3056978-01 50 µg

Recombinant Human MRPL3 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human MRPL3 Protein, N-His
orb3056978-02 100 µg

Recombinant Human MRPL3 Protein, N-His

Sign In for Pricing
View Details