Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human C14orf166 protein

This Human C14orf166 protein spans the amino acid sequence from region 1-244aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CLE7 homolog

UniProt

Q9Y224

Expression Region

1-244aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

55.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-225AA: 1-244AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MFRRKLTALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCPFKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNSKTADNATKNAEPLINLDVNNPDFKAGVMALANLLQIQRHDDYLVMLKAIRILVQERLTQDAVAKANQTKEGLPVALDKHILGFDTGDAVLNEAAQILRLLHIEELRELQTKINEAIVAVQAIIADPKTDHRLGKVGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Emc2 Pre-designed siRNA Set A
SI104257A 1 Each

Mouse Emc2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
LyP-1
T40555 25 mg

LyP-1

Sign In for Pricing
View Details
CNDP2, CT (CNDP2, CN2, CPGL, PEPA, Cytosolic non-specific dipeptidase, CNDP dipeptidase 2, Glutamate carboxypeptidase-like protein 1, Peptidase A) (PE) discontinued
034036-PE 200 µL

CNDP2, CT (CNDP2, CN2, CPGL, PEPA, Cytosolic non-specific dipeptidase, CNDP dipeptidase 2, Glutamate carboxypeptidase-like protein 1, Peptidase A) (PE) discontinued

Sign In for Pricing
View Details
Recombinant Micromonospora echinospora 2-deoxy-scyllo-inosose synthase (gtmA)
MBS1446285-01 0.02 mg (E-Coli)

Recombinant Micromonospora echinospora 2-deoxy-scyllo-inosose synthase (gtmA)

Sign In for Pricing
View Details
Recombinant Micromonospora echinospora 2-deoxy-scyllo-inosose synthase (gtmA)
MBS1446285-02 0.02 mg (Yeast)

Recombinant Micromonospora echinospora 2-deoxy-scyllo-inosose synthase (gtmA)

Sign In for Pricing
View Details
Recombinant Micromonospora echinospora 2-deoxy-scyllo-inosose synthase (gtmA)
MBS1446285-03 0.1 mg (E-Coli)

Recombinant Micromonospora echinospora 2-deoxy-scyllo-inosose synthase (gtmA)

Sign In for Pricing
View Details