Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ANAPC10 protein

This Human ANAPC10 protein spans the amino acid sequence from region 1-185aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cyclosome subunit 10

UniProt

Q9UM13

Expression Region

1-185aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-375AA: 1-185AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSIR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eribulin Impurity 26
RM-E180226-01 10 mg

Eribulin Impurity 26

Sign In for Pricing
View Details
Eribulin Impurity 26
RM-E180226-02 25 mg

Eribulin Impurity 26

Sign In for Pricing
View Details
Eribulin Impurity 26
RM-E180226-03 50 mg

Eribulin Impurity 26

Sign In for Pricing
View Details
Eribulin Impurity 26
RM-E180226-04 100 mg

Eribulin Impurity 26

Sign In for Pricing
View Details
HUNK Antibody
CSB-PA009180-01 50 µg

HUNK Antibody

Sign In for Pricing
View Details
HUNK Antibody
CSB-PA009180-02 100 µg

HUNK Antibody

Sign In for Pricing
View Details