Human ANAPC10 protein
This Human ANAPC10 protein spans the amino acid sequence from region 1-185aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Cyclosome subunit 10
UniProt
Q9UM13
Expression Region
1-185aa
Tag
N-terminal GST-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Cell Biology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
48.1 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
N-terminal GST-tagged: N-terminal GST-tagged1-375AA: 1-185AAFull Length : Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
TTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSIR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6327134-01 0.1 mL
NUDT19, ID (NUDT19, Nucleoside diphosphate-linked moiety X motif 19, mitochondrial) (MaxLight 490)
Sign In for Pricing
View Details MBS6327134-02 5x 0.1 mL
NUDT19, ID (NUDT19, Nucleoside diphosphate-linked moiety X motif 19, mitochondrial) (MaxLight 490)
Sign In for Pricing
View Details 
MBS7035643-01 0.02 mg
Recombinant Bacillus subtilis Negative regulatory protein yxlE (yxlE)
Sign In for Pricing
View Details MBS7035643-02 0.1 mg
Recombinant Bacillus subtilis Negative regulatory protein yxlE (yxlE)
Sign In for Pricing
View Details MBS7035643-03 5x 0.1 mg
Recombinant Bacillus subtilis Negative regulatory protein yxlE (yxlE)
Sign In for Pricing
View Details orb1358938 100 µg
Superoxide Dismutase 1 (SOD1) Human Over-expression Lysate
Sign In for Pricing
View Details