Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human S100A3 protein

This Human S100A3 protein spans the amino acid sequence from region 1-101aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein S-100E S100 calcium-binding protein A3

UniProt

P33764

Expression Region

1-101aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-297AA: 1-101AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCPSEPPCSQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pigeon Paraneoplastic Antigen-Like Protein 6A (PNMA6A) ELISA Kit
MBS9937724 Inquire

Pigeon Paraneoplastic Antigen-Like Protein 6A (PNMA6A) ELISA Kit

Sign In for Pricing
View Details
EBF3 (Transcription Factor COE3, Early B Cell Factor 3, EBF-3, Olf-1/EBF-like 2, O/E-2, OE-2, COE3) discontinued
E0254-75B 50 µg

EBF3 (Transcription Factor COE3, Early B Cell Factor 3, EBF-3, Olf-1/EBF-like 2, O/E-2, OE-2, COE3) discontinued

Sign In for Pricing
View Details
Rabbit Olfactory receptor 2M3 (OR2M3) ELISA kit
GTR10438473 96 Well

Rabbit Olfactory receptor 2M3 (OR2M3) ELISA kit

Sign In for Pricing
View Details
Recombinant Mouse TNFR2 / TNFRSF1B Protein, Fc His Tag
KMP1459 50 µg

Recombinant Mouse TNFR2 / TNFRSF1B Protein, Fc His Tag

Sign In for Pricing
View Details
Recombinant Campylobacter Jejuni ate Protein (aa 1-239) (strain 81-176)
VAng-Ly2532-500gEcoli 500 µg (E. coli)

Recombinant Campylobacter Jejuni ate Protein (aa 1-239) (strain 81-176)

Sign In for Pricing
View Details
9-O-β-D-Glucopyranosyl-3,4-dimethoxy-cinnamic acid
TN11431-01 10 mg

9-O-β-D-Glucopyranosyl-3,4-dimethoxy-cinnamic acid

Sign In for Pricing
View Details