Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human S100A3 protein

This Human S100A3 protein spans the amino acid sequence from region 1-101aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein S-100E S100 calcium-binding protein A3

UniProt

P33764

Expression Region

1-101aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-297AA: 1-101AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCPSEPPCSQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

6530418L21Rik siRNA Oligos set (Mouse)
10848174 3x 5 nmol

6530418L21Rik siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Hnrpdl siRNA Oligos set (Rat)
23769176 3x 5 nmol

Hnrpdl siRNA Oligos set (Rat)

Sign In for Pricing
View Details
HOXC6 CRISPR Knock Out 293T Cell Line (Human)
23836141 1x 10^6 Cells / 1.0 mL

HOXC6 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
GPR35 Human siRNA Oligo Duplex (Locus ID 2859)
SR301916 1 Kit

GPR35 Human siRNA Oligo Duplex (Locus ID 2859)

Sign In for Pricing
View Details
0.5ml Conical Tube With Screw Cap, Natural, 500/Bag
TK341-N 1PK, 500UNIT

0.5ml Conical Tube With Screw Cap, Natural, 500/Bag

Sign In for Pricing
View Details
Daporinad (FK866)
S2799-50mg 50 mg

Daporinad (FK866)

Sign In for Pricing
View Details