Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human S100A3 protein

This Human S100A3 protein spans the amino acid sequence from region 1-101aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein S-100E S100 calcium-binding protein A3

UniProt

P33764

Expression Region

1-101aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-297AA: 1-101AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCPSEPPCSQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

EZSolution™ Wnt Antagonist, C59
9493-1 1 mg

EZSolution™ Wnt Antagonist, C59

Sign In for Pricing
View Details
Anti-human Factor XI, Sheep, Purified IgG
5D-10126S 5 mg

Anti-human Factor XI, Sheep, Purified IgG

Sign In for Pricing
View Details
pUNO1-mSLPI
puno1-mslpi 20 µg

pUNO1-mSLPI

Sign In for Pricing
View Details
Polyclonal Antibody to Regulating Synaptic Membrane Exocytosis 2 (RIMS2)
TRV-0045584-01 20 µL

Polyclonal Antibody to Regulating Synaptic Membrane Exocytosis 2 (RIMS2)

Sign In for Pricing
View Details
Polyclonal Antibody to Regulating Synaptic Membrane Exocytosis 2 (RIMS2)
TRV-0045584-02 100 µL

Polyclonal Antibody to Regulating Synaptic Membrane Exocytosis 2 (RIMS2)

Sign In for Pricing
View Details
Polyclonal Antibody to Regulating Synaptic Membrane Exocytosis 2 (RIMS2)
TRV-0045584-03 200 µL

Polyclonal Antibody to Regulating Synaptic Membrane Exocytosis 2 (RIMS2)

Sign In for Pricing
View Details