Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human KCTD15 protein

This Human KCTD15 protein spans the amino acid sequence from region 1-234aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Potassium channel tetramerization domain-containing protein 15

UniProt

Q96SI1

Expression Region

1-234aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

53.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-178AA: 1-234AAFull Length : Full Length of Isoform 2

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPHRKERPSGSSLHTHGSTGTAEGGNMSRLSLTRSPVSPLAAQGIPLPAQLTKSNAPVHIDVGGHMYTSSLATLTKYPDSRISRLFNGTEPIVLDSLKQHYFIDRDGEIFRYVLSFLRTSKLLLPDDFKDFSLLYEEARYYQLQPMVRELERWQQEQEQRRRSRACDCLVVRVTPDLGERIALSGEKALIEEVFPETGDVMCNSVNAGWNQDPTHVIRFPLNGYCRLNSVQDVL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Hydrazino-5-methylpyridine (5-Methyl-2-pyridylhydrazine)
H8941-15 100 mg

2-Hydrazino-5-methylpyridine (5-Methyl-2-pyridylhydrazine)

Sign In for Pricing
View Details
ATP6V1G2 Polyclonal Antibody, PE Conjugated
bs-10930R-PE 100 µL

ATP6V1G2 Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
LRCH4 siRNA Oligos set (Human)
27585171 3x 5 nmol

LRCH4 siRNA Oligos set (Human)

Sign In for Pricing
View Details
2- (3-Bromophenyl) -5-butyl-1,3,4-oxadiazole
413384-01 100 mg

2- (3-Bromophenyl) -5-butyl-1,3,4-oxadiazole

Sign In for Pricing
View Details
2- (3-Bromophenyl) -5-butyl-1,3,4-oxadiazole
413384-02 250 mg

2- (3-Bromophenyl) -5-butyl-1,3,4-oxadiazole

Sign In for Pricing
View Details
IGLL5 Rabbit Polyclonal Antibody
orb1880042-01 30 µL

IGLL5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details