Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IRGM protein

This Human IRGM protein spans the amino acid sequence from region 1-181aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunity-related GTPase family M protein 1 Interferon-inducible protein 1 LPS-stimulated RAW 264.7 macrophage protein 47 homolog

UniProt

A1A4Y4

Expression Region

1-181aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-218AA: 1-178AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEAMNVEKASADGNLPEVISNIKETLKIVSRTPVNITMAGDSGNGMSTFISALRNTGHEGKASPPTELVKATQRCASYFSSHFSNVVLWDLPGTGSATTTLENYLMEMQFNRYDFIMVASAQFSMNHVMLAKTAEDMGKKFYIVWTKLDMDLSTGALPEVQLLQIRENVLENLQKERVCEY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

3DPS-3.2x50mm-B7646YL Pre-sized Sleeves for Printers
622498 2500 Roll (2500 Sleeve (s) x 1 Roll)

3DPS-3.2x50mm-B7646YL Pre-sized Sleeves for Printers

Sign In for Pricing
View Details
LOC100360413 Antibody - middle region
ARP48165_P050-25UL 25 µL

LOC100360413 Antibody - middle region

Sign In for Pricing
View Details
LACTB2 Antibody
orb1336537 100 µg

LACTB2 Antibody

Sign In for Pricing
View Details
Lentiviral human SALL4 shRNA (UAS) - Lentiviral human SALL4 shRNA (UAS) (100)
GTR15314085 1 Vial

Lentiviral human SALL4 shRNA (UAS) - Lentiviral human SALL4 shRNA (UAS) (100)

Sign In for Pricing
View Details
Asrgl1 AAV siRNA Pooled Vector
12569166 1.0 µg

Asrgl1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
FDCSP Antibody
orb1555505-01 50 μL

FDCSP Antibody

Sign In for Pricing
View Details