Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CROT protein

This Human CROT protein spans the amino acid sequence from region 1-87aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Carnitine O octanoyltransferase, COT, CROT, OCTC_HUMAN, Peroxisomal carnitine acyltransferase, Peroxisomal carnitine O octanoyltransferase, Peroxisomal carnitine O-octanoyltransferase

UniProt

Q9UKG9

Expression Region

1-87aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-247AA: 1-87AAFull Length of BC063666 : Full Length of Isoform 2

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MENQLAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVKPFANQEEYKKTEEIVQKFQSGIGEKLHQKLLERAKGKRNWVFVVIIE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prap1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6883607 1.0 µg DNA

Prap1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
OR9A1P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1547107 1.0 µg DNA

OR9A1P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
EEA1 Mouse mAb
C05038-100ul 100 µL

EEA1 Mouse mAb

Sign In for Pricing
View Details
Recombinant Nitrosomonas europaea Heme A synthase (ctaA), partial
MBS7090906 Inquire

Recombinant Nitrosomonas europaea Heme A synthase (ctaA), partial

Sign In for Pricing
View Details
Recombinant Human UBA1 Protein
E30P61560A 50 µg

Recombinant Human UBA1 Protein

Sign In for Pricing
View Details
Ephb1 (Ephrin Type-B Receptor 1, Ephb1) (Biotin) discontinued
302419-Biotin 200 µL

Ephb1 (Ephrin Type-B Receptor 1, Ephb1) (Biotin) discontinued

Sign In for Pricing
View Details