Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CHMP1B protein

This Human CHMP1B protein spans the amino acid sequence from region 1-199aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CHMP1.5 Chromatin-modifying protein 1b

UniProt

Q7LBR1

Expression Region

1-199aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-151AA: 1-199AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSNMEKHLFNLKFAAKELSRSAKKCDKEEKAEKAKIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEHQFETLDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVGTSVASAEQDELSQRLARLRDQV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rab11-FIP3 Antibody
OM635821-01 100 µL

Rab11-FIP3 Antibody

Sign In for Pricing
View Details
Rab11-FIP3 Antibody
OM635821-02 20 µL

Rab11-FIP3 Antibody

Sign In for Pricing
View Details
Rab11-FIP3 Antibody
OM635821-03 50 µL

Rab11-FIP3 Antibody

Sign In for Pricing
View Details
RG1 Reference Antibody (19G9)
orb1817830 100 µg

RG1 Reference Antibody (19G9)

Sign In for Pricing
View Details
NDUFB9 293 Cell Lysate
408224 0.1 mg

NDUFB9 293 Cell Lysate

Sign In for Pricing
View Details
FGF 8 Recombinant Protein
32-1175-25 25 µg

FGF 8 Recombinant Protein

Sign In for Pricing
View Details