Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CHMP1B protein

This Human CHMP1B protein spans the amino acid sequence from region 1-199aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CHMP1.5 Chromatin-modifying protein 1b

UniProt

Q7LBR1

Expression Region

1-199aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-151AA: 1-199AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSNMEKHLFNLKFAAKELSRSAKKCDKEEKAEKAKIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEHQFETLDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVGTSVASAEQDELSQRLARLRDQV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIRT4 (GST-tagged), Human recombinant
7673-20 20 µg

SIRT4 (GST-tagged), Human recombinant

Sign In for Pricing
View Details
Btd Rat siRNA Oligo Duplex (Locus ID 306262)
SR501427 1 Kit

Btd Rat siRNA Oligo Duplex (Locus ID 306262)

Sign In for Pricing
View Details
POTEG Antibody
orb1329303 100 µg

POTEG Antibody

Sign In for Pricing
View Details
Lentiviral human SULF1 sgRNA gene knockout kit - Lentiviral human SULF1 sgRNA gene knockout kit (25)
GTR15392187 1 Vial

Lentiviral human SULF1 sgRNA gene knockout kit - Lentiviral human SULF1 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Anti-Beta 2 microglobulin Antibody (C21)
MBS4160911-01 0.1 mL

Anti-Beta 2 microglobulin Antibody (C21)

Sign In for Pricing
View Details
Anti-Beta 2 microglobulin Antibody (C21)
MBS4160911-02 5x 0.1 mL

Anti-Beta 2 microglobulin Antibody (C21)

Sign In for Pricing
View Details