Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CHMP1B protein

This Human CHMP1B protein spans the amino acid sequence from region 1-199aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CHMP1.5 Chromatin-modifying protein 1b

UniProt

Q7LBR1

Expression Region

1-199aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-151AA: 1-199AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSNMEKHLFNLKFAAKELSRSAKKCDKEEKAEKAKIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEHQFETLDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVGTSVASAEQDELSQRLARLRDQV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIK3R2 Rabbit Polyclonal Antibody
54419-01 50 µL

PIK3R2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PIK3R2 Rabbit Polyclonal Antibody
54419-02 100 µL

PIK3R2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ERBB3 Polyclonal Antibody
bs-1454R-TR 20 µL

ERBB3 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human C-Myc Binding Protein
MBS144459-01 0.005 mg

Recombinant Human C-Myc Binding Protein

Sign In for Pricing
View Details
Recombinant Human C-Myc Binding Protein
MBS144459-02 0.02 mg

Recombinant Human C-Myc Binding Protein

Sign In for Pricing
View Details
Recombinant Human C-Myc Binding Protein
MBS144459-03 1 mg

Recombinant Human C-Myc Binding Protein

Sign In for Pricing
View Details