Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BOLL protein

This Human BOLL protein spans the amino acid sequence from region 1-283aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Bol (Drosophila boule homolog) like, Bol, Bol boule like, Bol, boule like (Drosophila), bol, boule-like (Drosophila), Boll, BOLL_HUMAN, BOULE, Boule like, BOULE, Drosophila, homolog of, Protein boule like, Protein boule-like, Putative uncharacterized protein BOLL

UniProt

Q8N9W6

Expression Region

1-283aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

58.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-211AA: 1-283AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MQTDSLSPSPNPVSPVPLNNPTSAPRYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKGYGFVTFETQEDAQKILQEAEKLNYKDKKLNIGPAIRKQQVGIPRSSIMPAAGTMYLTTSTGYPYTYHNGVAYFHTPEVTSVPPPWPSRSVCSSPVMVAQPIYQQPAYHYQATTQYLPGQWQWSVPQPSASSAPFLYLQPSEVIYQPVEIAQDGGCVPPPLSLMETSVPEPYSDHGVQATYHQVYAPSAITMPAPVMQPEPIKTVWSIHY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Leukocyte Antigen Class 1B Antibody (Anti-LA1B) ELISA Kit
MBS9389833-01 48 Well

Canine Leukocyte Antigen Class 1B Antibody (Anti-LA1B) ELISA Kit

Sign In for Pricing
View Details
Canine Leukocyte Antigen Class 1B Antibody (Anti-LA1B) ELISA Kit
MBS9389833-02 96 Well

Canine Leukocyte Antigen Class 1B Antibody (Anti-LA1B) ELISA Kit

Sign In for Pricing
View Details
Canine Leukocyte Antigen Class 1B Antibody (Anti-LA1B) ELISA Kit
MBS9389833-03 5x 96 Well

Canine Leukocyte Antigen Class 1B Antibody (Anti-LA1B) ELISA Kit

Sign In for Pricing
View Details
Canine Leukocyte Antigen Class 1B Antibody (Anti-LA1B) ELISA Kit
MBS9389833-04 10x 96 Well

Canine Leukocyte Antigen Class 1B Antibody (Anti-LA1B) ELISA Kit

Sign In for Pricing
View Details
RN5S102 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV743398 1.0 µg DNA

RN5S102 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Mouse Slc12a9 Pre-designed siRNA Set A
SI113001A 1 Each

Mouse Slc12a9 Pre-designed siRNA Set A

Sign In for Pricing
View Details