Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BOLL protein

This Human BOLL protein spans the amino acid sequence from region 1-283aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Bol (Drosophila boule homolog) like, Bol, Bol boule like, Bol, boule like (Drosophila), bol, boule-like (Drosophila), Boll, BOLL_HUMAN, BOULE, Boule like, BOULE, Drosophila, homolog of, Protein boule like, Protein boule-like, Putative uncharacterized protein BOLL

UniProt

Q8N9W6

Expression Region

1-283aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

58.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-211AA: 1-283AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MQTDSLSPSPNPVSPVPLNNPTSAPRYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKGYGFVTFETQEDAQKILQEAEKLNYKDKKLNIGPAIRKQQVGIPRSSIMPAAGTMYLTTSTGYPYTYHNGVAYFHTPEVTSVPPPWPSRSVCSSPVMVAQPIYQQPAYHYQATTQYLPGQWQWSVPQPSASSAPFLYLQPSEVIYQPVEIAQDGGCVPPPLSLMETSVPEPYSDHGVQATYHQVYAPSAITMPAPVMQPEPIKTVWSIHY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human/Rat CCR4 Phycoerythrin MAb (Clone 205410)
FAB1567P-025 25 Tests

Human/Rat CCR4 Phycoerythrin MAb (Clone 205410)

Sign In for Pricing
View Details
Anti-SLC7A4 Antibody Picoband® Biotin Conjugated
A12638-3-Biotin 100 µg/Vial

Anti-SLC7A4 Antibody Picoband® Biotin Conjugated

Sign In for Pricing
View Details
Sheep Fibronectin type III domain containing protein 3A (FNDC3A) ELISA kit
GTR10452941 96 Well

Sheep Fibronectin type III domain containing protein 3A (FNDC3A) ELISA kit

Sign In for Pricing
View Details
Rabbit Polyclonal MRCK Antibody [Allophycocyanin]
NBP1-46822APC 0.1 mL

Rabbit Polyclonal MRCK Antibody [Allophycocyanin]

Sign In for Pricing
View Details
MicroGripper Assembly; box of 20 assemblies
B-M7-50-B1A-R 20 Mounts/Base Assemblies

MicroGripper Assembly; box of 20 assemblies

Sign In for Pricing
View Details
2-Methylpentanoic acid
S3314-100mg 100 mg

2-Methylpentanoic acid

Sign In for Pricing
View Details