Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ATP5J protein

This Human ATP5J protein spans the amino acid sequence from region 1-108aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F6, ATP synthase-coupling factor 6, mitochondrial, ATP synthase-coupling factor 6, mitochondrial, ATP5, ATP5A, ATP5J, ATP5J_HUMAN, ATPase subunit F6, ATPM, CF6, F6

UniProt

P18859

Expression Region

1-108aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Disease Biomarkers

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-181AA: 1-108AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NKELDPIQKLFVDKIREYKSKRQTSGGPVDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKFEVIEKPQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pim-1 kinase inhibitor 10
orb2565472-01 10 mg

Pim-1 kinase inhibitor 10

Sign In for Pricing
View Details
Pim-1 kinase inhibitor 10
orb2565472-02 50 mg

Pim-1 kinase inhibitor 10

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1526), CF647 conjugate, 0.1mg/mL
BNC471526-500 1x 500 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1526), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PPP1R3A Adenovirus (Rat)
37453056 1.0 mL

PPP1R3A Adenovirus (Rat)

Sign In for Pricing
View Details
TRIM63 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
47831111 3x 1.0 µg

TRIM63 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Human Lambda Light Chain Recombinant Antibody, PE Conjugated
bsm-61628R-PE-TR 20 µL

Human Lambda Light Chain Recombinant Antibody, PE Conjugated

Sign In for Pricing
View Details