Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ATP5J protein

This Human ATP5J protein spans the amino acid sequence from region 1-108aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F6, ATP synthase-coupling factor 6, mitochondrial, ATP synthase-coupling factor 6, mitochondrial, ATP5, ATP5A, ATP5J, ATP5J_HUMAN, ATPase subunit F6, ATPM, CF6, F6

UniProt

P18859

Expression Region

1-108aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Disease Biomarkers

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-181AA: 1-108AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NKELDPIQKLFVDKIREYKSKRQTSGGPVDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKFEVIEKPQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nidogen2 Rabbit pAb, PerCP-Cy7 conjugated
orb2842043 100 µL

Nidogen2 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
SF3B3 HDR Plasmid (h)
sc-408209-HDR 20 µg

SF3B3 HDR Plasmid (h)

Sign In for Pricing
View Details
CREB3L2 Antibody
R34290-100UG 100 µg

CREB3L2 Antibody

Sign In for Pricing
View Details
Cyclin M2 Polyclonal Antibody, PE-Cy7 Conjugated
bs-6912R-PE-Cy7 100 µL

Cyclin M2 Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
Recombinant Pseudomonas mendocina Carbon storage regulator homolog (csrA)
MBS1149701-01 0.02 mg (E-Coli)

Recombinant Pseudomonas mendocina Carbon storage regulator homolog (csrA)

Sign In for Pricing
View Details
Recombinant Pseudomonas mendocina Carbon storage regulator homolog (csrA)
MBS1149701-02 0.1 mg (E-Coli)

Recombinant Pseudomonas mendocina Carbon storage regulator homolog (csrA)

Sign In for Pricing
View Details