Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ARF3 protein

This Human ARF3 protein spans the amino acid sequence from region 1-181aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ADP ribosylation factor 3, ADP-ribosylation factor 3, ARF3, ARF3_HUMAN, small GTP binding protein

UniProt

P61204

Expression Region

1-181aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-276AA: 1-181AAFull Length of Isoform 2 : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNKK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Protein Phosphatase 2, Regulatory Subunit B'' Alpha (PPP2R3a)
RPU58073-01 50 µg

Recombinant Human Protein Phosphatase 2, Regulatory Subunit B'' Alpha (PPP2R3a)

Sign In for Pricing
View Details
Recombinant Human Protein Phosphatase 2, Regulatory Subunit B'' Alpha (PPP2R3a)
RPU58073-02 100 µg

Recombinant Human Protein Phosphatase 2, Regulatory Subunit B'' Alpha (PPP2R3a)

Sign In for Pricing
View Details
Recombinant Human Protein Phosphatase 2, Regulatory Subunit B'' Alpha (PPP2R3a)
RPU58073-03 1 mg

Recombinant Human Protein Phosphatase 2, Regulatory Subunit B'' Alpha (PPP2R3a)

Sign In for Pricing
View Details
Mouse Monoclonal anti-human MR
hAP-0817 50 µg

Mouse Monoclonal anti-human MR

Sign In for Pricing
View Details
1-Dodecanoyl-sn-glycerophosphoethanolamine
T29298-01 100 mg

1-Dodecanoyl-sn-glycerophosphoethanolamine

Sign In for Pricing
View Details
1-Dodecanoyl-sn-glycerophosphoethanolamine
T29298-02 25 mg

1-Dodecanoyl-sn-glycerophosphoethanolamine

Sign In for Pricing
View Details