What is the catalog number for Human ARF3 protein?

The catalog number for Human ARF3 protein is orb54326.

What sizes are available for Human ARF3 protein?

Human ARF3 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Human ARF3 protein come in?

Human ARF3 protein is available in 3 different pack sizes.

Is Human ARF3 protein in stock?

Human ARF3 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human ARF3 protein

This Human ARF3 protein spans the amino acid sequence from region 1-181aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ADP ribosylation factor 3, ADP-ribosylation factor 3, ARF3, ARF3_HUMAN, small GTP binding protein

UniProt

P61204

Expression Region

1-181aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-276AA: 1-181AAFull Length of Isoform 2 : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNKK