Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ANXA8L2 protein

This Human ANXA8L2 protein spans the amino acid sequence from region 1-276aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ANXA8L1, ANXA8L2Annexin A8-like protein 1

UniProt

Q5VT79

Expression Region

1-276aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

57.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-331AA: 1-276AAFull Length of BC025709 : Full Length of Isoform 2

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAWWKAWIEQEGVTVKSSSHFNPDPDAETLYKAMKGIGVGSQLLSHQAAAFAFPSSALTSVSPWGQQGHLCCNPAGTNEQAIIDVLTKRSNTQRQQIAKSFKAQFGKDLTETLKSELSGKFERLIVALMYPPYRYEAKELHDAMKGSRDDVSSFVDPALALQDAQDLYAAGEKIRGTDEMKFITILCTRSATHLLRVKCTQNLHSYFAERLYYAMKGAGTRDGTLIRNIVSRSEIDLNLIKCHFKKMYGKTLSSMIMEDTSGDYKNALLSLVGSDP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acid Invertase Microplate Assay Kit
RDSM026 100 Assays

Acid Invertase Microplate Assay Kit

Sign In for Pricing
View Details
Mouse Tia1 activation kit by CRISPRa
GA204344 1 Kit

Mouse Tia1 activation kit by CRISPRa

Sign In for Pricing
View Details
ARMC7 (NM_024585) Human Recombinant Protein
TP303960M 100 µg

ARMC7 (NM_024585) Human Recombinant Protein

Sign In for Pricing
View Details
Uncoated Human TFF3 (Trefoil Factor 3, Intestinal) ELISA Kit
E-UNEL-H0275-01 5x 96 Tests

Uncoated Human TFF3 (Trefoil Factor 3, Intestinal) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human TFF3 (Trefoil Factor 3, Intestinal) ELISA Kit
E-UNEL-H0275-02 15x 96 Tests

Uncoated Human TFF3 (Trefoil Factor 3, Intestinal) ELISA Kit

Sign In for Pricing
View Details
PAK2 (Ab-197) Antibody
8B8162-AAT 50 µg

PAK2 (Ab-197) Antibody

Sign In for Pricing
View Details