Human ANXA8L2 protein
This Human ANXA8L2 protein spans the amino acid sequence from region 1-276aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
ANXA8L1, ANXA8L2Annexin A8-like protein 1
UniProt
Q5VT79
Expression Region
1-276aa
Tag
N-terminal GST-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Cardiovascular Research
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
57.7 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
N-terminal GST-tagged: N-terminal GST-tagged1-331AA: 1-276AAFull Length of BC025709 : Full Length of Isoform 2
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MAWWKAWIEQEGVTVKSSSHFNPDPDAETLYKAMKGIGVGSQLLSHQAAAFAFPSSALTSVSPWGQQGHLCCNPAGTNEQAIIDVLTKRSNTQRQQIAKSFKAQFGKDLTETLKSELSGKFERLIVALMYPPYRYEAKELHDAMKGSRDDVSSFVDPALALQDAQDLYAAGEKIRGTDEMKFITILCTRSATHLLRVKCTQNLHSYFAERLYYAMKGAGTRDGTLIRNIVSRSEIDLNLIKCHFKKMYGKTLSSMIMEDTSGDYKNALLSLVGSDP
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
F4204 96 Tests
Non-secretory ribonuclease (RNASE2) Porcine ELISA Kit
Sign In for Pricing
View Details 
MBS712777-01 0.1 mL
Rabbit anti-human pirin (iron-binding nuclear protein) polyclonal Antibody
Sign In for Pricing
View Details MBS712777-02 5x 0.1 mL
Rabbit anti-human pirin (iron-binding nuclear protein) polyclonal Antibody
Sign In for Pricing
View Details MBS6290654-01 0.2 mL
D4S234E, NT (NSG1, D4S234, Neuron-specific protein family member 1, Brain neuron cytoplasmic protein 1) (Azide free) (HRP)
Sign In for Pricing
View Details MBS6290654-02 5x 0.2 mL
D4S234E, NT (NSG1, D4S234, Neuron-specific protein family member 1, Brain neuron cytoplasmic protein 1) (Azide free) (HRP)
Sign In for Pricing
View Details