Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ANXA8L2 protein

This Human ANXA8L2 protein spans the amino acid sequence from region 1-276aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ANXA8L1, ANXA8L2Annexin A8-like protein 1

UniProt

Q5VT79

Expression Region

1-276aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

57.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-331AA: 1-276AAFull Length of BC025709 : Full Length of Isoform 2

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAWWKAWIEQEGVTVKSSSHFNPDPDAETLYKAMKGIGVGSQLLSHQAAAFAFPSSALTSVSPWGQQGHLCCNPAGTNEQAIIDVLTKRSNTQRQQIAKSFKAQFGKDLTETLKSELSGKFERLIVALMYPPYRYEAKELHDAMKGSRDDVSSFVDPALALQDAQDLYAAGEKIRGTDEMKFITILCTRSATHLLRVKCTQNLHSYFAERLYYAMKGAGTRDGTLIRNIVSRSEIDLNLIKCHFKKMYGKTLSSMIMEDTSGDYKNALLSLVGSDP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytoplasmic dynein 2 light intermediate chain 1 (DYNC2LI1) Human ELISA Kit
C7880 96 Tests

Cytoplasmic dynein 2 light intermediate chain 1 (DYNC2LI1) Human ELISA Kit

Sign In for Pricing
View Details
FITC-PEG-OH (MW 10000)
orb3028542-01 50 mg

FITC-PEG-OH (MW 10000)

Sign In for Pricing
View Details
FITC-PEG-OH (MW 10000)
orb3028542-02 10 mg

FITC-PEG-OH (MW 10000)

Sign In for Pricing
View Details
6-Hydroxypyridine-3-boronic acid pinacol ester
MBS9025002-01 1 g

6-Hydroxypyridine-3-boronic acid pinacol ester

Sign In for Pricing
View Details
6-Hydroxypyridine-3-boronic acid pinacol ester
MBS9025002-02 5x 1 g

6-Hydroxypyridine-3-boronic acid pinacol ester

Sign In for Pricing
View Details
FUT8 Recombinant Protein (Mouse)
RP135440 100 µg

FUT8 Recombinant Protein (Mouse)

Sign In for Pricing
View Details