Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SPAG16 protein

This Human SPAG16 protein spans the amino acid sequence from region 1-183aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pf20 protein homolog

UniProt

Q8N0X2

Expression Region

1-183aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-198AA: 1-183AAFull Length : Full Length of Isoform 4

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAAQRGMPSSAVRVLEEALGMGLTAAGDARDTADAVAAEGAYYLEQVTITEASEDDYEYEEIPDDNFSIPEGEEDLAKAIQMAQEQATDTEILERKTVLPSKHAVPEVIEDFLCNFLIKMGMTRTLDCFQSEWYELIQKGVTELRTVGNVPDVYTQIMLLENENKNLKKDLKHYKQAAEYVIF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Anti-Trastuzumab Antibody Elisa Kit
QY-E05919 96 Tests

Human Anti-Trastuzumab Antibody Elisa Kit

Sign In for Pricing
View Details
EGFP Rabbit Polyclonal Antibody (Fluoro550)
orb3087833 200 µL

EGFP Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
GNAQ Rabbit mAb
52317 50 µL

GNAQ Rabbit mAb

Sign In for Pricing
View Details
Lentiviral human ZFAND6 sgRNA gene knockout kit - Lentiviral human ZFAND6 sgRNA gene knockout kit (plasmid)
GTR15378401 1 Vial

Lentiviral human ZFAND6 sgRNA gene knockout kit - Lentiviral human ZFAND6 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Cyclin M3 (CNNM3) (NM_017623) Human Tagged ORF Clone Lentiviral Particle
RC205591L1V 200 µL

Cyclin M3 (CNNM3) (NM_017623) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
F10, CT (Coagulation Factor X, Stuart Factor, Stuart-Prower Factor, Factor X Light Chain, Factor X Heavy Chain, Activated Factor Xa Heavy Chain) (AP) discontinued
F0019-40-AP 200 µL

F10, CT (Coagulation Factor X, Stuart Factor, Stuart-Prower Factor, Factor X Light Chain, Factor X Heavy Chain, Activated Factor Xa Heavy Chain) (AP) discontinued

Sign In for Pricing
View Details